PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.247040.1
Common NameCsa_6G327430, LOC101205991
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 327aa    MW: 36456.6 Da    PI: 6.6313
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.247040.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.66.3e-34162220159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK vk+s++prsYYrCt+agC vkk+vers++dp++v++tYeg+H+h+
  Cucsa.247040.1 162 LDDGYRWRKYGQKAVKNSPYPRSYYRCTTAGCGVKKRVERSSDDPSIVVTTYEGQHTHQ 220
                     59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.5E-36147222IPR003657WRKY domain
SuperFamilySSF1182903.4E-30154222IPR003657WRKY domain
PROSITE profilePS5081132.937157222IPR003657WRKY domain
SMARTSM007749.2E-41162221IPR003657WRKY domain
PfamPF031061.5E-27163220IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MEEEKIKEEV LRNNRDQNSM GNPGLLFSDA IIPNNHTTNL FDFPLIDTID SSFKPSTFLD  60
LLATQDYTPS LFDLFSPPPP PPQPPLPLPS SAVAESSEVL NTPTTPNSSS VSCSSTERAF  120
DNDDVDRDKS PFNKQLKAKK KNQKKGREPR FAFMTKSEVD HLDDGYRWRK YGQKAVKNSP  180
YPRSYYRCTT AGCGVKKRVE RSSDDPSIVV TTYEGQHTHQ SPIMPRGALS STAFTPSPQQ  240
QPPLVFSQPQ QLYRNQFTYA PAPPADVVTC GGGFGHVFHS FGEERRLIDG RTTTTTSTTT  300
TDSFQDHGLL QDMIVPFPEE KEKKVN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-30152222777Probable WRKY transcription factor 4
2lex_A1e-30152222777Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6835180.0LN683518.1 Cucumis melo genomic scaffold, unassembled_sequence31001.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011657294.10.0PREDICTED: probable WRKY transcription factor 48
SwissprotO229001e-51WRK23_ARATH; Probable WRKY transcription factor 23
TrEMBLA0A0A0KD610.0A0A0A0KD61_CUCSA; Uncharacterized protein
STRINGVIT_05s0077g00730.t013e-73(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100234114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.13e-47WRKY DNA-binding protein 48
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]